PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00373g00096.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 475aa    MW: 52177.4 Da    PI: 5.9702
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00373g00096.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.21.8e-33249303155
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               kpr+rWtpeLHe Fveav++LGGsekAtPk +l+lm+v++Lt++hvkSHLQkYR+
  Peaxi162Scf00373g00096.1 249 KPRMRWTPELHEVFVEAVNKLGGSEKATPKGVLKLMNVESLTIYHVKSHLQKYRT 303
                               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.546246306IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-31247305IPR009057Homeodomain-like
SuperFamilySSF466893.23E-18248303IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-25249303IPR006447Myb domain, plants
PfamPF002491.5E-9251302IPR001005SANT/Myb domain
PfamPF143795.3E-24334380IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MNMRPALYMS RSGEAQSSMG ISGAMPTSLP SLPKLEEKYP KLPDSLHVIS DKELTANLIS  60
PRAIPSTSKS GTVGHLLSST SGSANDLHFS PTSPQETRPR YYPFISSEAS MEASEASQSS  120
IRSTSLDNNP LENKFNTWGK DSFHEFIAFP TNVPSPNGQV ESLAGVMVSD DHAKRPDWQE  180
WADQLINDDD NLGSSWSDIL IDVNLPDPES KLLGVSEIPA SKPQVPPPPP PPASSGQSFQ  240
VGSPSATAKP RMRWTPELHE VFVEAVNKLG GSEKATPKGV LKLMNVESLT IYHVKSHLQK  300
YRTARYKPEP SEGTSEKKPT TVTEMPSLDL KTTMGITEAL RMQMEVQKQL HDQLEIQRKL  360
QLRIEEQGKY LQMMFEKTKN MGKEINVSSS HSDEPPSPSI ERKHSPPDDK SNTLVKDHVS  420
VGLGSDDAPS SVEDLTKNDE RKSPERNTCE NRESGGRDIG SPPAKRAKAE EKSAS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006340463.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A0V0ICE00.0A0A0V0ICE0_SOLCH; Uncharacterized protein
STRINGPGSC0003DMT4000603240.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45822139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.19e-87phosphate starvation response 1